PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00013.1.g05330.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 354aa    MW: 37769.6 Da    PI: 6.2703
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00013.1.g05330.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.51.1e-31219274156
                         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                     k+r++W+peLH++Fv a++qLGG+++AtPk+i+e+m+v+gLt+++vkSHLQkYRl+
  Zjn_sc00013.1.g05330.1.sm.mkhc 219 KARRCWSPELHRQFVAALHQLGGPQVATPKQIREVMQVDGLTNDEVKSHLQKYRLH 274
                                     68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.744216276IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-28217277IPR009057Homeodomain-like
SuperFamilySSF466892.51E-16217277IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-25219274IPR006447Myb domain, plants
PfamPF002491.2E-7221272IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MGLDVGEIGV GLDLGLDLRL FAARSAGRMA SAGGSAAVDA CIKGLEEERR KIEMFRRELP  60
LCARLLADVI EELKEEAVKR GGDAAPTKAD DADKRKWMST AQLWVDSEAK SEESEKEQQS  120
EITSPESEFL GGAPMPLRAV AAAQPPPPLC FRPEDMVAGT VGLVAMPVLP PSGKRPLSPV  180
PAGDEHRQNL AARFAATMPP SAPALSVHAQ TQQQQQARKA RRCWSPELHR QFVAALHQLG  240
GPQVATPKQI REVMQVDGLT NDEVKSHLQK YRLHNRRSPS AAPETQQVVL VGGLWVPKEQ  300
SSSQSGSPQC PLQFSGSGSG VNAASAASIG GDGNSSSSSD EDDKSEGYSR KLTV
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9620864e-67EU962086.1 Zea mays clone 240112 DNA binding protein mRNA, complete cds.
GenBankKJ7280554e-67KJ728055.1 Zea mays clone pUT6201 G2-like transcription factor (GLK44) mRNA, partial cds.
GenBankKJ7280564e-67KJ728056.1 Zea mays clone pUT6202 G2-like transcription factor (GLK44) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981657.11e-135PREDICTED: probable transcription factor GLK1
TrEMBLA0A059Q2Z51e-139A0A059Q2Z5_9POAL; DNA binding protein
STRINGSi036412m1e-135(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP181737107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.15e-37G2-like family protein